SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000945 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000945
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily EF-hand 1.03e-23
Family Parvalbumin 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000945   Gene: ENSMGAG00000001485   Transcript: ENSMGAT00000001593
Sequence length 109
Comment pep:novel chromosome:UMD2:16:994984:998344:-1 gene:ENSMGAG00000001485 transcript:ENSMGAT00000001593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTDILSPSDIAAALRDCQAPDSFSPKKFFQISGMSKKSSSQLKEIFRILDNDQSGFIE
EDELKYFLQRFECGARVLTASETKTFLAAADHDGDGKIGAEEFQEMVQS
Download sequence
Identical sequences A0A091GD88 G1MRU2 P43305
ENSGALP00000005475 ENSMGAP00000000945 NP_989753.1.86415 XP_003210592.1.16129 XP_009564313.1.62272 XP_013032542.1.65836 XP_015149613.1.86415 XP_021267313.1.32913 ENSGALP00000005475 ENSMGAP00000000945 9031.ENSGALP00000005475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]