SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000986 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000986
Domain Number 1 Region: 69-223
Classification Level Classification E-value
Superfamily EF-hand 2.31e-26
Family Calmodulin-like 0.022
Further Details:      
 
Domain Number 2 Region: 197-295
Classification Level Classification E-value
Superfamily EF-hand 0.000000000122
Family Calmodulin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000986   Gene: ENSMGAG00000001504   Transcript: ENSMGAT00000001635
Sequence length 322
Comment pep:novel chromosome:UMD2:5:1053871:1060357:-1 gene:ENSMGAG00000001504 transcript:ENSMGAT00000001635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGCLNLLLLCLLCLREGTLLIRTKFHSSYRKIFAINKQRIVEKNRLFEKRAEEIISACTF
VTYIKCVTKQGHGLLKKIVDRIDENKDGYLTTEELKNWIKRVQKRYIYENVAKVWKDYDT
NKDNKITWEEYKQATYGYYLENPEEFQDATDRHSFKKMLPRDERRFKTADLDGDSAATRE
EFTAFLHPEEFEHMKNIVVLETLEDIDKNEDGFVDQDEYIADMFANEEGGPEPDWVTTER
EQFSDFRDLNKDGKMDKEEIQHWILPQDYDHALAEARHLVYESDVDKDQKLTKEEVLDNW
NMFVGSQATNYGEDLTRNHDEL
Download sequence
Identical sequences G1MRX2
ENSMGAP00000000986 ENSMGAP00000000986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]