SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000998 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000998
Domain Number 1 Region: 25-113
Classification Level Classification E-value
Superfamily EF-hand 2.47e-24
Family S100 proteins 0.0000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000998   Gene: ENSMGAG00000001541   Transcript: ENSMGAT00000001647
Sequence length 116
Comment pep:novel chromosome:UMD2:7:419765:420487:-1 gene:ENSMGAG00000001541 transcript:ENSMGAT00000001647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KASLQPNPVDVPIASLRSQDCAVTMSELEKAMIAIIDAFHQYSGKEGDKHKLKKSELKEL
INNELTHFLGEIKDQETVDKVMEALDSDGDAECDFQEFVAFIAMVTSACHEFFEHE
Download sequence
Identical sequences G1MRY2
ENSMGAP00000000998 ENSMGAP00000000998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]