SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001307 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001307
Domain Number 1 Region: 82-205
Classification Level Classification E-value
Superfamily EF-hand 1.22e-22
Family Calmodulin-like 0.017
Further Details:      
 
Domain Number 2 Region: 4-111
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000728
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001307   Gene: ENSMGAG00000001775   Transcript: ENSMGAT00000001960
Sequence length 243
Comment pep:novel chromosome:UMD2:13:1330610:1334218:1 gene:ENSMGAG00000001775 transcript:ENSMGAT00000001960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPGNGYIEGKELENFFQELESARKGTGVDSKRDSLGDKMKEFMHKYDKNADGKIEMAEL
AQILPTEENFLLCFRQHVGSSSEFMEAWRRYDTDRSGYIEANELKGFLSDLLKKANRPYD
EAKLQEYTQTILRMFDMNGDGKLGLSEMSRLLPVQENFLLKFQGMKLSSEEFNAIFAFYD
KDGSGFIDEHELDALLKDLYEKNKKEMSIQQLTNYRRSIMNLSDGGKLYRKELEVVLCSE
PPL
Download sequence
Identical sequences G1MSK7
ENSMGAP00000001307 ENSMGAP00000001307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]