SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001471 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001471
Domain Number 1 Region: 50-196
Classification Level Classification E-value
Superfamily EF-hand 6.34e-34
Family Calmodulin-like 0.00000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001471   Gene: ENSMGAG00000001941   Transcript: ENSMGAT00000002131
Sequence length 198
Comment pep:novel chromosome:UMD2:29:2202422:2207443:1 gene:ENSMGAG00000001941 transcript:ENSMGAT00000002131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRIAPPGRSHPSAMPLKKSDPKKDAAKAAAAPEAPKEFTFDPKSVKIEFAAEQIEEFKEA
FSLFDRTPTGAMQISYAQCGDVLRALGHNPTNAEVLKVLGKPKPEDMNTKMLDFETFLPI
LQHFTRTREQGTFEDFVEGLRVFDKEGNGLVMGAELRHVLVTLGEKMTESEVEQLMAGQE
DANGCINYEAFVKHIMSG
Download sequence
Identical sequences G1MSY3
ENSMGAP00000001471 ENSMGAP00000001471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]