SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001658 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001658
Domain Number 1 Region: 281-378
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 445-733
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.83e-17
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.051
Further Details:      
 
Domain Number 3 Region: 201-294
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000083
Family V set domains (antibody variable domain-like) 0.076
Further Details:      
 
Domain Number 4 Region: 28-80
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000652
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 5 Region: 111-194
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000784
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001658   Gene: ENSMGAG00000002115   Transcript: ENSMGAT00000002322
Sequence length 795
Comment pep:novel chromosome:UMD2:4:3496052:3646438:-1 gene:ENSMGAG00000002115 transcript:ENSMGAT00000002322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYTGQDGHFKSCENKYCGLGRHCVVNGESGQAECVCMEHCKPHYKPVCGSDGEFYENHCE
VHRAACLKKQKVTIVHNEDCFFKGDKCKPTEYSKVKNMLLDLQNQRYAAQSKDRNVGEKM
ALRKLLVDQMFHYFDSDSNGLVDTNELSQVIKRDELGKDLSDCSLFDLLKYDDYNSDKHL
GLEEFYRAFQVVQLSLPEDQKLSTTAATVGQSAVLSCAIQGALRPPIIWKRNNVILNNLD
LEDISDFGDDGSLYITKVTTTHMGNYTCYADGYDKLYQTHILQVNVPPVIRVYPESQARE
PGVTASLRCHAEGIPNPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTC
IAKNEAGVDEDISSLFVEDSARKTPVANILWREQGLGIGNMFYVFYEDGIKVIQPVECEF
QRHIKPSEKLLGFQDEVCPKAAGDSVQRCVWATAVNVKDKFIYVTQPTLDRVLIVDVQSQ
KVVQAVSTDPVPVKLHYDKSHDQVWVQSWGNMEKNSPTLQVITQASGSVSHHTIHTQPVG
KQFDRVDDFFIPATTLIITHIRFGFILHKDEPMLQKIDLETMSYIKTISLKDYNCIPQSL
AYTHLGGLFFIYCKPDTTGAVLPQLIVDSVTDSVIGYNGDVTGRPHVSPDGHYLVSIDDA
KGLMRIQIITMRGEIQDAFDIHTNLHISDVAFQPSFTEAHQYNIYCSSSTQTDVLFVELS
SGKVKMVKSLKEPVRAGEWPWNSKNRLIKDSGLFGQYLMTPSKESLFILDGRLNKLNCEI
TEVERGNTVIWVGEA
Download sequence
Identical sequences G1MTD4
ENSMGAP00000001658 ENSMGAP00000001658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]