SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001668 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001668
Domain Number 1 Region: 867-1029
Classification Level Classification E-value
Superfamily EF-hand 2.71e-24
Family Calmodulin-like 0.021
Further Details:      
 
Domain Number 2 Region: 698-852
Classification Level Classification E-value
Superfamily EF-hand 9.74e-19
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001668   Gene: ENSMGAG00000002109   Transcript: ENSMGAT00000002332
Sequence length 1112
Comment pep:novel chromosome:UMD2:11:2830104:2869004:-1 gene:ENSMGAG00000002109 transcript:ENSMGAT00000002332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATYRLMVTTVNCYSSVVIEQHFQHTVHYCPGTCQVFKQGVACIVAHHSVCAELSVQDA
NLDHKIPVSENGLALPGNEDYQQILLNNPRIKKGSSVQASGSLKDITGEAINLASGKIKE
FSFEKLKNSSNHVAYRKGRKVRSESFSRRSFDFDMIYGHFSNDENSPPCGFLQSPSPVEK
WQESNDAPEVSMNPMVPFSPHSFSDENFITQILEKHKLDGSSGGDIKVCLDILLKCSEDL
KKCTDIIKHCIKKKSAGSVSGGSSSDPLASSEMIYMNLMRRFSSYLKKLPFEFKPPGHKE
AGDLGELVNCFHGLQQSPFSPIFGDEQPPRYEDIIQLPSSNAVPVRPPGDQCEVTSASQS
IQTSTVSFTSNSLCSTSQENSVRAVKDASVLPQLPATSPSDCTPSTEVLYIEEESDGERV
LEKTTRAKEKGDWESLKHSYQLSGSSDVIADVKAEPTRIGGELSHTSEKSNLLKPISDSV
LRGSQGGVSKGEQTCKIDKDEIDKLLLDLEHFSQKMESTFREPPPKESEPACLQGRPVLP
VALEPKSKPNDPTSPLSKIVETNGHKMEEDDRALLLRILESIEDFAQELVEFQTGKGSLS
KEKEVMQILQETLSTPSQSLLAGQKSHAGAASRDSVPALIQQAPEVIKVQSKQEKKPGTS
SPVPLNSVVSPCALPVNKATSSTPLSANIPRFYFPKGLPNVCTNHEEIIARIEAAFTEFE
DEKANICEMGKIAKICGCPLYWKAPMFSASGGQRTGCVSVHSFVSLWRKILRNCHDDASR
FAYLVAKPSCGYLEQEDFIPLLQDVVETHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRS
WSGKITLTELRKSNFLQTLALLEEEDDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQ
KDLARYSDQALSSRIIERIFSGAVVRGNEVQKEGRMSYADFVWLLISEEDKRNATSIEYW
FRCMDLDGDGVLSMYELEYFYEEQCERMEVMGIEPLPFQDLLCQMLDLVKPEREGRVTLR
DLKRCRMAHVFYNTFFNLEKYLDNEQRDPFAVQKDFENDGPEPSDWDRYAAEEYEILVAE
ESGNEQLQEGSFEEDYETDEVLSPSETGDKSN
Download sequence
Identical sequences G1MTE2
ENSMGAP00000001668 ENSMGAP00000001668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]