SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001784 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001784
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily EF-hand 7.46e-25
Family Calmodulin-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001784   Gene: ENSMGAG00000002229   Transcript: ENSMGAT00000002451
Sequence length 182
Comment pep:novel chromosome:UMD2:21:1069649:1126629:-1 gene:ENSMGAG00000002229 transcript:ENSMGAT00000002451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEF
MTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHILYHAFRDHLTMKDIENII
INEEESLNENSGNCQTEFEAVHAQKQNRQTCVRKSLICAFAMAFIISVMLIAANQILRSG
ME
Download sequence
Identical sequences G1MTN5
ENSMGAP00000001784 ENSMGAP00000001784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]