SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001945 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001945
Domain Number 1 Region: 33-101
Classification Level Classification E-value
Superfamily EF-hand 0.000000000123
Family Calmodulin-like 0.035
Further Details:      
 
Domain Number 2 Region: 257-316
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.00000000197
Family PA3566-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001945   Gene: ENSMGAG00000002364   Transcript: ENSMGAT00000002616
Sequence length 355
Comment pep:novel chromosome:UMD2:22:2652153:2672951:-1 gene:ENSMGAG00000002364 transcript:ENSMGAT00000002616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADYSEPGQPRRRKSVASLDSELSSYLMLGSSVFFHIFRRADKNDDGKLSFEEFKNYFADG
ILSSEELWELFSGIDRRHSDNVDTEKLCDYFSAYLGEYRNVLSALETLNSAVLAAMDKTK
LSYETSSKMEQFLTRFLLRETMHQLQSLQGSLECAVDTMEEQAGRERKDIKISETLVGLR
SGRRCGRRGQKNICLSPTDPYSGMLTTGVCVEADSQWMAEISRLQQLIEKLECKSPRLEP
LKEEATCKGRDESILVAKRQISVAKGGIEEFRQALRSYMEVTTAQSSCLHVSACKLTDEA
CFILYEFWQDAASWRSTLKLNVQKKKKRKNRKLSPTSLPMSKVHMYRYVFKKNNN
Download sequence
Identical sequences G1MU00
ENSMGAP00000001945 ENSMGAP00000001945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]