SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002012 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002012
Domain Number 1 Region: 31-157
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 3.92e-58
Family N-terminal domain of cbl (N-cbl) 0.000000193
Further Details:      
 
Domain Number 2 Region: 244-330
Classification Level Classification E-value
Superfamily SH2 domain 2.09e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 336-414
Classification Level Classification E-value
Superfamily RING/U-box 5.96e-43
Family RING finger domain, C3HC4 0.00000906
Further Details:      
 
Domain Number 4 Region: 158-243
Classification Level Classification E-value
Superfamily EF-hand 2.14e-38
Family EF-hand modules in multidomain proteins 0.00000543
Further Details:      
 
Domain Number 5 Region: 852-886
Classification Level Classification E-value
Superfamily UBA-like 0.0000133
Family UBA domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002012   Gene: ENSMGAG00000002406   Transcript: ENSMGAT00000002684
Sequence length 899
Comment pep:novel chromosome:UMD2:26:4476138:4506630:-1 gene:ENSMGAG00000002406 transcript:ENSMGAT00000002684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKKGPGGLIGLMKDAFQPHHHHLGPHQPGAVDKKMVEKCWKLMDKVVRLCQNPKLALKNS
PPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERM
YEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIV
PWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNS
LAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPH
NKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQL
CKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGGG
GLSRQGAEGTPSPNYDDDDDDRADDSLFMMKELAGTKVERPPSPFSVAPQATLPPVPPRL
DLLQQRASNPPGASSPSTSSKAVPGTLHKDKPLPIPPTLRDLPPPPPPDRPHSIGTDARP
QRRPLPCTPADCPARDKPPPVPTNRQGDPWPSRPIPKAPSVAHSPGDHWPGRELSNRHSL
PFSLPSQMDSRPESHRLGSTLSLDNPVSLNAGPPATSECEHPKIKPSSSANAIYSLAARP
LPVPKLPAGEQSESDEDTEYMSPSSLPVVPPGPAVQKPEIKMPLEMTQSLRVLECDRQTD
GCMYEAMYNIHSQAVPSAFETINTSDEGDLAAATASNGPEESENEEDGYDIPKPPLPVAI
ARRTLSDISNATPAFSRMSLENDPVTGFSDGSQVPERPPKPLPRRINSERKAGSCQPGAA
SSSTGASLQLSSEIENLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAHVAT
Download sequence
Identical sequences G1MU46
ENSMGAP00000002012 ENSMGAP00000002012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]