SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002062 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002062
Domain Number 1 Region: 19-97
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.74e-41
Family variant PHD-like domain 0.0000419
Further Details:      
 
Domain Number 2 Region: 89-218
Classification Level Classification E-value
Superfamily EF-hand 0.000000000171
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002062   Gene: ENSMGAG00000002475   Transcript: ENSMGAT00000002735
Sequence length 297
Comment pep:novel chromosome:UMD2:Z:8655972:8657612:1 gene:ENSMGAG00000002475 transcript:ENSMGAT00000002735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKPGSHAEHPLVLSCSIAPQVLNDEMCEICEVWTAESLFPCRVCSRVYHDGCLRRMGYLQ
NNSAVEVTETAHTETGWSCYYCDNLNLLLTEEEMYSLMETLRQCKIIPETSLTLDDFLHY
KHLVHKQQFERPMEEAQEERATLQFSALDPDKKGHIEWPDFLSHESIQLLQKLRPPNSLL
RLLTVKERERARAAFLALDQDGSGFIGEGECHKAQHSWFRKHQKETPSCSVSISHVGPMS
ESSPASSGSSKSQEKTLLASEQEETRSIDWPRFLKENVAYILAARPNSAAIHLQPPA
Download sequence
Identical sequences G1MU83
ENSMGAP00000002062 ENSMGAP00000002062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]