SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002095 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002095
Domain Number 1 Region: 14-169
Classification Level Classification E-value
Superfamily EF-hand 1.49e-43
Family Calmodulin-like 0.0000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002095   Gene: ENSMGAG00000002502   Transcript: ENSMGAT00000002768
Sequence length 188
Comment pep:novel chromosome:UMD2:1:25406:30295:-1 gene:ENSMGAG00000002502 transcript:ENSMGAT00000002768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNNNSSTVDDLQAVEIHHWYKKFMTECPSGQLTEHEFKQFFGLRGLDPQANEYIEQMFR
TFDMNKDGYIDFMEYVAALSLVLRGKMEQKLRWYFKLYDVDGNGCIDRHELLNIIKAIRA
INGGDHETSAEEFTNRVFNKIDVNGDGELSLDEFVEGARKDDEFMEVMMKSLDLSHIVAM
INNRRHSV
Download sequence
Identical sequences G1MUB0
ENSMGAP00000002095 XP_021240447.1.32913 ENSMGAP00000002095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]