SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002363 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002363
Domain Number 1 Region: 45-192
Classification Level Classification E-value
Superfamily EF-hand 2.38e-35
Family Calmodulin-like 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002363   Gene: ENSMGAG00000002731   Transcript: ENSMGAT00000003040
Sequence length 194
Comment pep:novel chromosome:UMD2:6:2921769:2957565:-1 gene:ENSMGAG00000002731 transcript:ENSMGAT00000003040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKPEPKKAPEPKKEEPKPAPKPAEPEPKKEVEFNPASIKVEFTPDQIEEFKEAFSLF
DRTPKSEMKITYAQCGDVLRALGQNPTQAEVMKVLGRPKQEDMNSKMIDFETFLPMLQHI
AKTKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEEEVDKLMAGQEDANG
CINYEAFVKHIMAN
Download sequence
Identical sequences G1MUW1
ENSMGAP00000002363 ENSMGAP00000002363 XP_003206959.1.16129 XP_015708474.1.68032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]