SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002904 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002904
Domain Number 1 Region: 194-358
Classification Level Classification E-value
Superfamily EF-hand 1.06e-23
Family Calmodulin-like 0.013
Further Details:      
 
Domain Number 2 Region: 92-165
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000107
Family Polcalcin 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002904   Gene: ENSMGAG00000003216   Transcript: ENSMGAT00000003594
Sequence length 363
Comment pep:novel chromosome:UMD2:23:2598155:2612192:1 gene:ENSMGAG00000003216 transcript:ENSMGAT00000003594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEEKGKTMMSRQAFLCSLGSLYLSLLFVFLLMDVYARPANNSALKEKPADSKDENEILPP
DHLNGVKMEMDGHLNKEFHQEVFLGKEMEEFEEDSEPRKNRKKLMVIFSKVDIDNDKKIS
AKEMQRWIMEKTDEHFQEAVEENKMHFRAVDPDGDGHVSWDEYKIKFLASKGLNEKEIAE
KIKNNEELKIDEETQEVLDNLKDRWYQADNPPPDMLLNEEEFLSFLHPEHSRGMLKFMVK
EIIRDLDQDGDKKLTLSEFISLPVGTVENQQAQDIDDDWVKDRRKEFEEVIDANHDGIVT
MEELEEYMDPMNEYNALNEAKQMIAVADENQNHHLELEEILKYSEYFTGSKLMDYARNVH
EEF
Download sequence
Identical sequences G1MW20
ENSMGAP00000002904 ENSMGAP00000002904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]