SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003057 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003057
Domain Number 1 Region: 75-228
Classification Level Classification E-value
Superfamily EF-hand 3.35e-23
Family Calmodulin-like 0.032
Further Details:      
 
Domain Number 2 Region: 4-96
Classification Level Classification E-value
Superfamily EF-hand 0.0000000416
Family Calbindin D9K 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003057   Gene: ENSMGAG00000003331   Transcript: ENSMGAT00000003751
Sequence length 237
Comment pep:novel chromosome:UMD2:12:2513177:2524035:-1 gene:ENSMGAG00000003331 transcript:ENSMGAT00000003751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFTDELSSWIQQSFKHYVTQEAKQHFQDYDKNGDGLVSWKEYNLQMYDRVIDFDENTVLE
DQEEESFRQLHLKEKKRFEKANRDDDPDLNVDEFIAFEHPEEVEYMMDFVTEEALEEHDK
DGDGFVSLEEFLGDYRRDPTAKEDPEWILVEKDRFVNDYDKDNDGKLNPQELLSWIVPNN
QGIAQEEALHLIEEMDLNDDKKLSEAEILKNQDLFLNSEATDYGRQLHDERFYHEEL
Download sequence
Identical sequences G1MWD6
ENSMGAP00000003057 ENSMGAP00000003057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]