SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003079 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003079
Domain Number 1 Region: 20-161
Classification Level Classification E-value
Superfamily EF-hand 1.45e-35
Family Calmodulin-like 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003079   Gene: ENSMGAG00000003342   Transcript: ENSMGAT00000003773
Sequence length 165
Comment pep:known chromosome:UMD2:21:4031843:4052641:-1 gene:ENSMGAG00000003342 transcript:ENSMGAT00000003773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKAKKKIEGGSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKADLRDTFAALGRLNV
KNEELEDMVKEAPGPINFTVFLTMFGEKLKGTDPEETILNAFKIFDPEGKGHIKADYIKE
MLMTQADRFSQEEINQMFAAFPPDVSGNLDYKNLCYVITHGEEKD
Download sequence
Identical sequences A0A1V4K2S7 A0A2I0M1S6 G1MWF2
ENSMGAP00000003079 ENSMGAP00000003079 XP_005502009.1.63277 XP_008493273.1.100939 XP_009818020.1.37116 XP_009865300.1.31609 XP_009883421.1.48241 XP_009909029.1.92783 XP_010004331.1.85724 XP_010074300.1.40768 XP_010167883.1.30499 XP_010291327.1.48707 XP_014808849.1.91963 XP_015736516.1.68032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]