SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003099 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003099
Domain Number 1 Region: 252-418,825-1004
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.2e-125
Family Mammalian PLC 0.00000937
Further Details:      
 
Domain Number 2 Region: 576-689
Classification Level Classification E-value
Superfamily SH2 domain 1.01e-30
Family SH2 domain 0.00000201
Further Details:      
 
Domain Number 3 Region: 477-593
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-27
Family SH2 domain 0.00042
Further Details:      
 
Domain Number 4 Region: 722-785
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-21
Family SH3-domain 0.0000321
Further Details:      
 
Domain Number 5 Region: 1033-1145
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-20
Family PLC-like (P variant) 0.0024
Further Details:      
 
Domain Number 6 Region: 2-70
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000146
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 
Domain Number 7 Region: 83-247
Classification Level Classification E-value
Superfamily EF-hand 0.00000036
Family Calmodulin-like 0.043
Further Details:      
 
Domain Number 8 Region: 417-454
Classification Level Classification E-value
Superfamily PH domain-like 0.0000545
Family Pleckstrin-homology domain (PH domain) 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003099   Gene: ENSMGAG00000003334   Transcript: ENSMGAT00000003793
Sequence length 1224
Comment pep:novel chromosome:UMD2:22:5124782:5142360:1 gene:ENSMGAG00000003334 transcript:ENSMGAT00000003793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVDIREIKEIRPGKNSRDFDRYQEDPCFRPDQSHCFVVLYGTEFRLKTLSLQATSEDEVN
MWIKGLNWLVADTLRAATPLQIERWLRKQFYTLDRNREDRISAKDLKNMLSQVNYRVPNM
RFLRERLTDMEQRNGDITYGQFAQLYRSLMFSAQKTMDVPFLDSFSPCALRGGERSEHFR
VSLMEFQKFLLEYQRELWAADSLQVQEFMFNFLRDPLREIDEPYFSLDEFLTFLFSKENS
IWNSQLDMVCPENMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDC
WDGPDGMPVIYHGHTLTTKIKFSDVLVTIKEHAFVTSDFPVILSIEDHCSIAQQRNMAQN
FKKVFGDMLLTKPVDISADGLPSPNQLKRKILIKHKKLAEGSAYEELPTSVMYSENDISN
SIKNGILYLEDPINHEWNPHYFVLTSSKIYYSGETTSDQGNEDEEEQKEVSNSTELHSTE
KWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHC
RIHSRQDAGSPKFFLTDNLVFDSLYDLITHYQEVPLRCNEFEMRLTEPVPQTNAHESKEW
YHANLTRAQAEHMLMRVPRDGAFLVRKRSEPSSYAISFRAEGKIKHCRVQQEGQTVLLGN
SEFESLVDLISYYEKHPLYRKMKLRYPINEETLEKIGTAEPDYGALYEGRHPGFYVEANP
MPTFKCAVKALFDYKAQREDELTFTKNAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEE
ISSPSSLEPEREQQLDENSPLGDLLGGVLDVPSCQIAIRPEGKNNRLFVFSISMASVSRL
SLDVAADTHEDLLDWVKKIREAAQTADARLSEGKMMERRKKIALELSELVVYCRPVPFDE
EKIGTERACYRDMSSFPETKAEKYVNKIKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLP
MWICGSQLVALNFQTPDKPMQMNQALFLSSGQCGYVLQPANMRDDIFDPFDKSTLRGVEP
LSISIEVPGGPGHLPKNGRGIVCPFVEVEVSGAEYDNAKQKTEIVADNGLNPLWSPKQFH
FQVSNPEFAFLRFVVYEEDMFSDENFLAQATFLVKGLKTGFRAVPLKNNYSENLELASLL
VKIDIFPSKENGDISLFGGSMLRERGGDMASQLLASRAREGSFEVRYQQPFEDFRVSQEQ
LAEHFESRERRALRRTRVNGDNRL
Download sequence
Identical sequences G1MWG7
ENSMGAP00000003099 ENSMGAP00000003099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]