SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003113 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003113
Domain Number 1 Region: 321-637
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.13e-130
Family Mammalian PLC 0.00000000126
Further Details:      
 
Domain Number 2 Region: 167-320
Classification Level Classification E-value
Superfamily EF-hand 3.04e-44
Family EF-hand modules in multidomain proteins 0.0000197
Further Details:      
 
Domain Number 3 Region: 657-781
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.04e-32
Family PLC-like (P variant) 0.0000197
Further Details:      
 
Domain Number 4 Region: 38-150
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-28
Family Pleckstrin-homology domain (PH domain) 0.00000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003113   Gene: ENSMGAG00000003387   Transcript: ENSMGAT00000003808
Sequence length 784
Comment pep:novel chromosome:UMD2:6:4109020:4148005:-1 gene:ENSMGAG00000003387 transcript:ENSMGAT00000003808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCIRRQPKRSVSQENILREQSRRVAALNGIRLGLKDDKDLKFLLKGSQLLKVKSSSWRK
ERFYKLQEDCKTIWQESKKMLRSPDSQIFSIEDIRDVRSGHKTEGMEKYAKDVPEYRCFS
IIFKDQRKNLDLIASSEDDANHWVNSLPEILQHFFSTTVQYRNRHSSCSWIHTCLRKADK
NKDNKMSFKELKNFLKEVNIEVDDYHAKEIFQYCDKSKTEALEDDEIEEFYKILTERKEI
DTIFQKYSDAEGLMSCQNLVRFLYETQQEEDAVVAAPPLIQRYEPSERAKKRNAMTKDGF
LMYLLSDDGNIFNTSHRKVYQDMTQPLSHYFVSSSHNTYLMDDQLTGPSSTEAYIRALTK
GCRCVELDCWDGPNSEPIIYHGYTLTSKILFCDVIKAIKNYAFKTSPYPVIISLENHCSL
DQQKVMAQHMTTILQDMLLVAPIDGSKSQFPSPEQLKGKILVKGKKLSRQEDPTGTNGNN
NLEAEDVSDEDEAAEMEDESVKTEVQQKGKRDTLKLAKELSDTVVYCKSVHFNGFEDPSH
PRAFYEMSSFTESKALKLAQESGNSFILHNIRHLSRIYPAGWRTDSSNYNPVDLWNVGCQ
IVALNFQTGGTEMDVYQGRFQDNGFSGYVLKPEFLRDEQTKFNPKSITEGTWGTKKKLLL
KIISGQQLPKVNKSKNSIVDPRVTIEIHGVQQDNNKKQTKVIENNGFNPKWDEEFTFDIE
IPALALVRFVVEDFDMSTKNDFIGQYTVPFTSLKQGYRHIHLLTKNGDPYSSSTLFVYVN
IQDC
Download sequence
Identical sequences G1MWH7
ENSMGAP00000003113 ENSMGAP00000003113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]