SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003121 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003121
Domain Number 1 Region: 318-594
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.02e-85
Family Mammalian PLC 0.00000416
Further Details:      
 
Domain Number 2 Region: 160-317
Classification Level Classification E-value
Superfamily EF-hand 7.67e-39
Family EF-hand modules in multidomain proteins 0.0062
Further Details:      
 
Domain Number 3 Region: 614-740
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.93e-29
Family PLC-like (P variant) 0.00027
Further Details:      
 
Domain Number 4 Region: 30-142
Classification Level Classification E-value
Superfamily PH domain-like 9.02e-27
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003121   Gene: ENSMGAG00000003418   Transcript: ENSMGAT00000003816
Sequence length 986
Comment pep:novel chromosome:UMD2:29:4467452:4472333:-1 gene:ENSMGAG00000003418 transcript:ENSMGAT00000003816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDGSRQRPMQKKTVSFSTMPNDRKINSAAACISFMLEGCELKKVRSNSRMYSRFFVLDTD
MRSVRWEPSKKDSEKAKIEIKSVKEVRVGKKTPILRSNGLSDQFPDECAFSIIYGDNYES
LDLVASSADVVSAWVMGLRYLLSYGKHTPEALGSGHPSLRTSWISSVFDLADLEKCGRIP
VSRAVQLIKALNPGMKVSTIELKFKELQKASERPGTEVACDLFVEAYCELCTRPEIFFLL
VQFSSNKEYLGLKDLLTFLEVEQGMEGVTEEKCLEIVSKYEPSKEGREKGYLAIDGFTRY
LLSSDCSIFDPQHRRVCQDMAQPLSHYYISSAHSACLLEDNFWGRSDISGYVSALGLGCR
SIELVLWDGPDGEPVVYTSPSAASCVPFRSVXCLRKTLGEKLYLEPPDPAASYLPSPEQL
KGRILIKGKKLPPGCEDSEGEVSDEEEGRELARRLGQEDREAVEGGVPRRVRLSRELSEL
VSLCQAVPFQDFESSRRGQRYWEMCSFSEVEAGRFTNECPAELVSYNKRFLSRVYPSPMR
IDASNMNPQDFWKCGCQMVAMNYQTPGLMMDLNAGWFRQNGACGYVLRPAIMREEVSYFS
ANAKDSLPGVPAQLLHLKVISGQNLPKPKGSGAKGEVVEPYVCAEIHGIPADCAEHRTKT
ALQSGDNPVFDESLEFQINLPELAVLRFVVLDDDYIGDEFIAQYTIPFECLQPGYRHVPL
QSLSGEPLPHATLFVHVAITDRRGGGKGHRRGLAGRRGRRVREYTSTKPTGIKAIDEVFR
TATQPLREATDLRENVQNALVSFKELCGLTPAANMKQCILTVAAWLLHSDSAPSVTLNLA
EQYPPMEAQGPIPDLLRKVLTAYETMIQTSRTLIESADAVHSKLIQAQQAGMDFHKELHR
IEAKEGLRGRKLQKALESFAWNITVLKGQADLLKHAKAEALDNLWQIHNAGQSCGIGRNG
LASPEPSRLRAPLEPIPEAEGGSDAA
Download sequence
Identical sequences G1MWI1
ENSMGAP00000003121 ENSMGAP00000003121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]