SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003311 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003311
Domain Number 1 Region: 312-661
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.62e-131
Family Mammalian PLC 0.0000000000952
Further Details:      
 
Domain Number 2 Region: 882-944,978-1154
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 9.68e-58
Family C-terminal domain of PLC-beta 0.0000000011
Further Details:      
 
Domain Number 3 Region: 143-311
Classification Level Classification E-value
Superfamily EF-hand 6.8e-49
Family EF-hand modules in multidomain proteins 0.0000000943
Further Details:      
 
Domain Number 4 Region: 11-141
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-43
Family Pleckstrin-homology domain (PH domain) 0.000000524
Further Details:      
 
Domain Number 5 Region: 681-799
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.82e-22
Family PLC-like (P variant) 0.00000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003311   Gene: ENSMGAG00000003529   Transcript: ENSMGAT00000004011
Sequence length 1211
Comment pep:known chromosome:UMD2:5:5847188:5888990:1 gene:ENSMGAG00000003529 transcript:ENSMGAT00000004011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMLTPVLQPPEVKEYLSRGERFIKWDDETASASPVILRVDPKGFYLYWTYQNKEMEILD
ITSIRDTRVGRFAKIPKCQKLREVFNLDYPHSTFLLKTLTIVSGPDMVDLTFHNFVSYKE
NVGKSWAEDIMAIVQNPLTYNASRYTFLEKILVKLKMQLNAEGKIPVRNIFQMFPADRKR
VEAALNACHLPKGKNDAINPEDFPETVYKTFLMNLCPRPEIDEIFTSHHFKAKPYMTKEH
LAKFINKKQRDSRLNDILFPPAKPEQVQSLIEKYEPSVINIQRGQLSPEGMVWFLCGPEN
NVIALDKLVLYQDMTQPLSHYFINSSHNTYLTAGQFSGISSPEMYRQTLLAGCRCVELDC
WKGRPPDEEPIITHGFTMTTEILFKDAIEAIAESAFKTSLYPVILSFENHVDSPKQQAKM
AEYCRTIFGDMLLTEPLEKYPLKPGVPLPSPKDLLGKILIKNKKKQFVSEKRQSSMKKGK
NVEPEIIEQPAFTDAEDTVWAGDVAEEEPEEEDDQLGNLDEEEIKKMQSDEGTAGLEVTA
YEEMSSLVNYIQPIKFDSFEVSAQKNRSYVISSFTELKAYDLLTKFPMQFVEYNKRQMSR
IYPKGTRMDSSNYMPQMFWNVGCQMVALNFQTMDVPMQQNMALFEFNGQCGYLLKHEFMR
RPDKQFDPFSVDRIDVVVASTVSVTILSGQFLSDRSVKTYVEVELFGLPRDTKRKYRTKL
TSTANSINPVWKEEPFVFEKIVMPELASLKIVAFEEGGKFIGHRVIPIIAVHSGYHHVCL
RSESNMPLTMPSLFVYLEVKDYVPDAWADLTIALSNPIKFFNLQEKRSVNLKDGSEVERP
DMQRNFSFPENNGIPESTRIFSTPFANGPAGAAALVKDGNMKEVTQLPEPQTASLAELQQ
MKLFLKLLKKQEKELKELERKGSKRREELLQKYSVLFLEPVYPRGKKRSMHSRKTQKKRS
LTTGDVGTCMQPVEMAEKLDSQVVELKERLEMELIHLGEEYHDGIRRRKEQHATEQTAKI
TELAREKQIAELKALKESSESNIKDIKKKLEAKRLDRIQVMMRSTSDKAAQERLKKEINN
SHIQEVVQTIKLLTEKTARYQQKLEEKQAENLRAIQEKEGQLQQEAVAEYEEKLKTLTVE
VQEVVKNYMKEVFPDGPEIQKEAVLSIPVEEQGSTNQLEEKIPGAEVPRLTAATTEPPGA
ETDINIEESIL
Download sequence
Identical sequences G1MWY7
ENSMGAP00000003311 ENSMGAP00000003311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]