SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003741 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003741
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily EF-hand 8.31e-43
Family Calmodulin-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003741   Gene: ENSMGAG00000003993   Transcript: ENSMGAT00000004448
Sequence length 152
Comment pep:novel chromosome:UMD2:5:6201506:6203621:-1 gene:ENSMGAG00000003993 transcript:ENSMGAT00000004448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRELRPEEIEELKQAFKEFDKDRDGYISYKDLGECMRTMGYMPTEMELIELSQQISPSAG
GKVDFDDFVELMGPKMLAETADMIGIKELRDAFREFDTNGDGQISMAELREAMRKLLGQQ
LNYREVDEILKDVDLNGDGLVDFEEFVRMMSR
Download sequence
Identical sequences G1MXX1
ENSMGAP00000003741 ENSMGAP00000003741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]