SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003792 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003792
Domain Number 1 Region: 45-190
Classification Level Classification E-value
Superfamily EF-hand 7.09e-38
Family Calmodulin-like 0.000000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003792   Gene: ENSMGAG00000004000   Transcript: ENSMGAT00000004500
Sequence length 192
Comment pep:known chromosome:UMD2:7:4789799:4806394:1 gene:ENSMGAG00000004000 transcript:ENSMGAT00000004500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKDVKKPAAAAAPAPAPAPAPAPAPAKPKEPAIDLKSIKIEFSKEQQDDFKEAFLLF
DKTGDAKITLSQVGDIVRALGQNPTNAEMNKILGNPSKEEMNAKKITFEEFLPMLQAAAN
NKDQGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVEELMKGQEDSNGCI
NYEAFVKHIMSV
Download sequence
Identical sequences Q6W5H1
NP_001290122.1.16129 ENSMGAP00000003792 ENSMGAP00000003792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]