SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004008 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004008
Domain Number 1 Region: 636-674
Classification Level Classification E-value
Superfamily SAP domain 0.000000201
Family SAP domain 0.0025
Further Details:      
 
Domain Number 2 Region: 146-207
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000454
Family Cold shock DNA-binding domain-like 0.0064
Further Details:      
 
Domain Number 3 Region: 921-967
Classification Level Classification E-value
Superfamily EF-hand 0.0000797
Family Calmodulin-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004008   Gene: ENSMGAG00000004166   Transcript: ENSMGAT00000004718
Sequence length 1149
Comment pep:novel chromosome:UMD2:8:12115545:12142556:1 gene:ENSMGAG00000004166 transcript:ENSMGAT00000004718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPTN
YQLTQTAALQQQAAAAAAALQQQYSQPQQTLYSVQQQLQQPQQTILTQPAVALPTSLSLS
TPQPAAQITVSYPAPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTP
QVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQTQAQPLLKTPPAVLQPIAQQTAFGVQA
QPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAGLLQPPVRLVSQPQPARRLDPPSR
FSGRNDRGGDPMPNRKDDRSRERDRERRRSRERSPQRKRSRERSPRRERERSPRRPRRVV
PRYTVQFSKFSLDCRSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPMSRPFQLGNYCNF
YVMHREVDPIDKNTAVLDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQELRDGFQ
HPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPDPEKDPSVLIKTAIRCCKALTGIDLSVC
TQWYRFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVE
KLQGERKEADGEQDEEEKDDGEAKEISTPTHWSKLDPKTMKVNDLRKELESRTLSSKGLK
SQLIARLTKQLKVEEQKEEQKELEKSEKEEEEEEDRKSEDDKEEEERKRQEEMERQRRER
RYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQ
RDFGVRIYKALISLPEREDKKDKKSKKDERKEKKEEKEEENDEPKPKRRKSGDDKDKKED
KDEKKREEKRKDDSKDEEETEDDNNQEEYDPMEAEEAEDEDEDREEEEMNKREDRREGNK
HCKERSSKDKEKDKTQMVTVNRDLLMAFVYFDQSHCGYLLEKDMEEILYTLGLHLSRAQV
KKLLNKVVLRESCFYRRLTDTSKDEENQEESEELQEDMLGNRLLLPSPTVKQESKAVEEN
VGLIVYNGAMVDVGSLLQKLEKSERVRAEIEQKLQLLEEKTDEDEKTILQLENSNKSLSG
ELKEVKKDLSQLQENLKISDEKNLQFESQLNKTIKNLATVMDEMQSVLKQKHIKMPEFVK
KKKSKLVLL
Download sequence
Identical sequences G1MYH8
ENSMGAP00000004008 ENSMGAP00000004008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]