SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004099 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004099
Domain Number 1 Region: 273-438
Classification Level Classification E-value
Superfamily EF-hand 2.19e-37
Family Calmodulin-like 0.003
Further Details:      
 
Domain Number 2 Region: 42-244
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 0.00000000000000314
Family Glycerol-3-phosphate (1)-acyltransferase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004099   Gene: ENSMGAG00000004311   Transcript: ENSMGAT00000004811
Sequence length 496
Comment pep:novel chromosome:UMD2:13:3430932:3453685:-1 gene:ENSMGAG00000004311 transcript:ENSMGAT00000004811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVILLLLSWLSASAATFRHTGGASVPLKGWRRRMIQATLSRLTRTLFFVMGFRVKVKGKV
ASLQEAPIFVAAPHSSFFDAIVSALTGMPSIVSRAENLSTPIFGTILSSLQPVAVSRQDP
DSRKNTVSEITNRALSRGQWPQILIFPEGTCTNRSCLITFKQGAFIPGVPVQPVLLRYPN
KLDTVTWTWQGYSLKELCIMTLCQLFTKVEVEFLPVYVPTEEERNDPVLFANRVRQTMAT
ALKVPVTDHTFEDCRLMISAGQLTLPMEAGLVEFTKISKKLNLKWNHVREQLDTFAAIAS
ASKGGRIGIEEFAEYLKLPISDVLRELFLLFDRNGDGTIDFREYVIGLSILCNPANTEET
IHMAFKLFDQDDDGTITEKEFACIIQSALGLPDLDVSNLFKEIDADETGKLSYDEFKNFA
LEHPEYAKLFTTYLELQRHQVGMAEEDDDIQPSEAKHTPIRKSAVLDSETRPTARNKVCP
ADYEEDNSSTSDKKDD
Download sequence
Identical sequences G1MYQ2
ENSMGAP00000004099 XP_010716113.1.16129 ENSMGAP00000004099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]