SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004306 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004306
Domain Number 1 Region: 17-164
Classification Level Classification E-value
Superfamily EF-hand 7.52e-43
Family Calmodulin-like 0.000000295
Further Details:      
 
Domain Number 2 Region: 422-684
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.33e-29
Family WD40-repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004306   Gene: ENSMGAG00000004474   Transcript: ENSMGAT00000005020
Sequence length 693
Comment pep:novel chromosome:UMD2:2:6199103:6210383:1 gene:ENSMGAG00000004474 transcript:ENSMGAT00000005020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQVKYCMLQGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQN
PLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGEL
FQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVSNLSGKFTGFSQQVNL
PVSKDKQAHPKSGECRFARAPDFPFQRCIALNADLEDSISANLWKHNTKSGGHHPTLLLS
SPSLKICSRRPAMLSVYLNCSTLKSEGQQRWKEHISVVEKVNVNVQNKNLHYMGIGRGGM
SKHLVYPVDSCTLKAALDGVWASWFGLPFAALCSASLPGCPCRSFTRTEQESSCSAGHSS
NIAINFGWWASCKRKYMLVHVLQKCCTALMLKSVSVWGNLTPSSQAQPPPPSELPAPNAG
AGTLGGKVRLQNLEAPEIPVYSVKGHKEIINSIDGVGGLGIGEGAPEIVTGSRDGTVKVW
DPRQKETPVANMEPAQGESKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLKTMSLRW
ETNIKNGVCSVEFDRKDVNMNKLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTIWQ
VRHLPQNRDVFMTSGGAGSLHLWKYEYPAQRSKKDSEGAEMGVAGSVSLLQNVTLSTQPI
SSLDWSPDKKGLCVCGAFDQTVRVLIVTKLNKV
Download sequence
Identical sequences G1MZ66
ENSMGAP00000004304 ENSMGAP00000004306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]