SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004316 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004316
Domain Number 1 Region: 11-170
Classification Level Classification E-value
Superfamily EF-hand 4.48e-42
Family Calmodulin-like 0.0000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004316   Gene: ENSMGAG00000004503   Transcript: ENSMGAT00000005030
Sequence length 199
Comment pep:novel chromosome:UMD2:28:3185760:3188488:-1 gene:ENSMGAG00000004503 transcript:ENSMGAT00000005030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNMDGKAVEELSATECHQWYKKFMTECPSGQLTLYEFKQFFGLKNLSPSANKYVEQMFE
TFDFNKDGYIDFMEYVAALSLVLKGKVDQKLRWYFKLYDVDGNGCIDRGELLNIIKAIRA
INRCNEAMTAEEFTNMVFDKIDINGDGELSLEEFMEGVQKDEVLLDILTRSLDLTHIVKL
IQNDGKNPHAPEEAEEAAQ
Download sequence
Identical sequences G1MZ78 P79880
ENSMGAP00000004316 ENSGALP00000002177 ENSGALP00000028327 9031.ENSGALP00000028327 NP_989651.1.86415 XP_003213006.1.16129 XP_021233209.1.32913 ENSGALP00000002177 ENSMGAP00000004316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]