SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004374 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004374
Domain Number 1 Region: 17-139,181-318,358-478
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.96e-39
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number 2 Region: 410-681
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-29
Family WD40-repeat 0.011
Further Details:      
 
Domain Number 3 Region: 738-850
Classification Level Classification E-value
Superfamily EF-hand 0.000000000107
Family Calmodulin-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004374   Gene: ENSMGAG00000004544   Transcript: ENSMGAT00000005090
Sequence length 907
Comment pep:novel chromosome:UMD2:17:5906611:5919477:1 gene:ENSMGAG00000004544 transcript:ENSMGAT00000005090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFQGEKQSCHPLSLSWALGYNSSLAVHSIEDGMLLYVCAHTVVVHDVLGSRQHHLQGHA
NAISCLCVSEDRRWVATADQGPDPLVIIWDAFSGIPVRTIFDSHAGSGVCAIAISRDAKC
LVTISAGMVQRVCMWRWTYPDESPVCYVELSPEFGFQDFVIFNPQNPYEFVSNSKTQVIF
YLWGDAGLQYSTPPLTKQTFGSTVGRFTQSAFHFNATQVLTGTSAGKVVVWDVERKRGLA
KEPQGRLHGMKATKLVPMQEESLTVLLVLESCIVTGDVRGQVKFYNGHLQLLACSDHSGT
GPIQSISFSKTPSDPPGASSTSSHPFAARIYHDCPAIRNFILSTSDATVLRVATDGTDFE
KVMKEAKKAVTAIACHPQQSWLAMGSHCGLLKVWDYKQLQLLVSRIFSSAGVQCLSYDPA
GSFLATGLTDGSVHVLDAISLLSCCEVFRFSRGPITHVQFSHDSEYLATADEKYAVTVYK
RVLQNERRCWEHLAGLHSHYKPIRSILFGIQLDGSEPRLLSLGEDRQLIEYDLSSSSKDQ
LVVLHRHRVEQAAVPLCLAWYPHFSTESFILTANSCYKMKLYNATTKMCRKTLLGPTYGS
PLEKMQILPKSAAEPQKRYLAYITKDKVGLQILPVDGNPHKSSAFICHPDGASDLAISYD
GRYIFTAGGSDRTVLKWEVNLNALEAAASLGGEDLVPFYRLLDGGQDGEFFRELEDYFYY
VQLRSHGIDMLESRQVSMYIPLEEIPSVMRAMGFYPSEEEIEEMINEVKFSEFVDTGEQV
TKINLRDFIKLYINHRPAFGLSMKTIRQAFQVLGYENENGDKVIDRGDLLSLLQCRGEHM
MEDELALCLSALLGRHPMGGRSDLDVCDPSGAAALMEEEIPEQITAERFTAGILGLSIAE
PEKRTVK
Download sequence
Identical sequences G1MZC0
ENSMGAP00000004374 ENSMGAP00000004374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]