SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004556 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004556
Domain Number 1 Region: 31-90
Classification Level Classification E-value
Superfamily EF-hand 0.000000117
Family Calmodulin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004556   Gene: ENSMGAG00000004728   Transcript: ENSMGAT00000005275
Sequence length 380
Comment pep:novel chromosome:UMD2:13:6034318:6053543:-1 gene:ENSMGAG00000004728 transcript:ENSMGAT00000005275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VALPPEKTDGVCSGDEKKAEKESDTRAGSKKQLKFEELQCDVSVEEDNRQEWTFTLYDFD
NNGRVTREDITSLLHTIYEVVDASVNHSPSSSKTLRVKLTVAPDGSQKKKSILLNHTDLQ
SARHRAESKANEELRSSEKKQRASLRYHQSENNPEQSECYRHCVDENIERRNHYLDLAGI
ENYTSKFGPGSPPAVQKHDPPSRVVSQTRSRSHEPETFHAHHRKSQVVDPSHINLAESSY
AKIAEIQQRLRNQDSNKHFVRSPKAQGKNVAPVHSGRAVRNKPFQAGAMSMASPSARVGQ
NLPYLPLQSQQVHKKHKQRAKENHQMCKTFQSPGTVVEKEHVRDLPTVILYEGQVGQMIQ
RHEHHHHHEHHHHYHHFYQT
Download sequence
Identical sequences G1MZQ9
ENSMGAP00000004556 ENSMGAP00000004556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]