SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004633 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004633
Domain Number 1 Region: 39-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-27
Family RecA protein-like (ATPase-domain) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004633   Gene: ENSMGAG00000004800   Transcript: ENSMGAT00000005354
Sequence length 279
Comment pep:novel chromosome:UMD2:6:6382886:6388341:-1 gene:ENSMGAG00000004800 transcript:ENSMGAT00000005354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSFFFSFISPGFKLLARLEGRSSLKNLEPNLFAEEGSPVHGDVIEFHGPEGTGKTEMLY
HLLARCIIPKSRGGLEVEVMFIDTDYHFDMFRLVTILEHRLEQSTEEMMKRCLGRLFLVN
CNSSTQLLLTLYSLENMFCTHPSLCLLILDSISAFYWIDRSNGGESLNSQEMNLKKCANF
LEKLVREHHLVLFATTQSIMQKSTNSAESFFPSKLQHEIDADYRPYLCKSWQQMVTHRIF
FSKQFNSGNSKGFMLVSCHLKKNHVAKRSFSIAECGVQF
Download sequence
Identical sequences G1MZW8
ENSMGAP00000004633 ENSMGAP00000004633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]