SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004752 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004752
Domain Number 1 Region: 13-106
Classification Level Classification E-value
Superfamily EF-hand 3.5e-20
Family S100 proteins 0.0000583
Further Details:      
 
Domain Number 2 Region: 114-208
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000153
Family S100 proteins 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004752   Gene: ENSMGAG00000004908   Transcript: ENSMGAT00000005473
Sequence length 211
Comment pep:novel scaffold:UMD2:GL425210.1:5440:10390:1 gene:ENSMGAG00000004908 transcript:ENSMGAT00000005473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCPQTPGVSMSCPLEQALAVMVSTFHKYSGKEGDKFKLSKAELKELLTRELPSFISKRTD
EAGFQKLMNNLDSNRDSEVDFHEYATFLACVAVMCNDFFQEYPDKMPRKNEMKTDLELAL
ECAINIYHHYAIRNPMDDYLSRNEFATLLKENAKPFLADTVPPNTSVDEYIKQLFAKSDS
NHDGRLKFTEFLTTLSLVAIDAHNRSHKKPG
Download sequence
Identical sequences H9H0S2
ENSMGAP00000004752 ENSMGAP00000004752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]