SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005348 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005348
Domain Number 1 Region: 8-352
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.35e-123
Family Calpain large subunit, catalytic domain (domain II) 0.000000133
Further Details:      
 
Domain Number 2 Region: 586-761
Classification Level Classification E-value
Superfamily EF-hand 2.84e-28
Family Penta-EF-hand proteins 0.00056
Further Details:      
 
Domain Number 3 Region: 378-495
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.66e-16
Family Calpain large subunit, middle domain (domain III) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005348   Gene: ENSMGAG00000005407   Transcript: ENSMGAT00000006081
Sequence length 763
Comment pep:novel chromosome:UMD2:2:9625074:9655011:-1 gene:ENSMGAG00000005407 transcript:ENSMGAT00000006081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNLSSALRLEQGMQTAGTTGGLQNLRKFNNQDFEHLRSLCLSQGLLFEDDTFPADISSI
GPNLLPKDELQQIVWKRPKELLRNPFLIMDGVSRFDIIQGEIGDCWMLAALGSLTMQKRF
LENVLPKDQGFQSDYAGIFHFRFWQFGDWVDVVIDDRLPFLNGNYLSVHPRTSNEFWPSL
LEKAYAKLQGSYQNLHGGYISDALVDFTGGVQMQFSLKDPPPYLEDILKAASKSQCLMGC
STSGRMRNTVLRNGIVQGHAYTVTGAVKIRFKNHWEHIIRVWNPWGHGEWKGPWSDGSPE
WDYVEPEIKEELYRKKNDGEFWMSCESFREQFSWLCVCNCTPTFLDFGDQHHTGWSVDRH
INLWSPLLTTGRSDYSSGAVSKNPQYFFKVTNYDPKSYNVVISLIQKNAEGMQDAQKLKI
GFFITMVSTVGKQSRQKQTYWNNTRKENSKVLKQDFSLTRDVSSCFNLSPGTYAVIPATT
EDREFEFVLRIFVKNQDYNDKLSKAWACPSHGSCSTHSIKRFVQNMERPIFSQRDVTQLF
SRNANSQLNPMLPMQFHALPGASSHALSQWFQSKVSINKGMLKDVPRQKQDSSYKAIFLK
YAKQGSAIDALQLQQLLNDMVLQDEMTSLGGEFSFDSCRAILALMDLNSNGQLTLQEFGS
LWRSVTNLCSEDLFKREDRNRSGFLDVSELKSAIQTAGLPVNEQILRLMALRYGDVYRRM
GFADFVSCMLRLETMTYAFQNLAKGGPQVLMTVMEWLTLVMYI
Download sequence
Identical sequences G1N1G7
ENSMGAP00000005348 ENSMGAP00000005348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]