SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005416 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005416
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily EF-hand 1.59e-51
Family Calmodulin-like 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005416   Gene: ENSMGAG00000005513   Transcript: ENSMGAT00000006149
Sequence length 191
Comment pep:novel chromosome:UMD2:25:5292273:5293163:-1 gene:ENSMGAG00000005513 transcript:ENSMGAT00000006149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKHGSKLAPEMLDDLVRSTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGD
ASKFAQHAFRTFDKNSDGTIDFREFICALSVTSRGTFEQKLNWAFEMYDLDGDGKITRLE
MLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFTKMDKDKDDQISLEEFKEAAKSDPS
IVLLLQGDVQK
Download sequence
Identical sequences G1N1L3
XP_003212668.1.16129 ENSMGAP00000005416 ENSMGAP00000005416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]