SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005432 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005432
Domain Number 1 Region: 197-259,403-437
Classification Level Classification E-value
Superfamily EF-hand 4.25e-16
Family Calmodulin-like 0.038
Further Details:      
 
Domain Number 2 Region: 302-436
Classification Level Classification E-value
Superfamily EF-hand 0.00000000032
Family Penta-EF-hand proteins 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005432   Gene: ENSMGAG00000005487   Transcript: ENSMGAT00000006165
Sequence length 474
Comment pep:known chromosome:UMD2:8:13168530:13260101:-1 gene:ENSMGAG00000005487 transcript:ENSMGAT00000006165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGLAAASRRYHGAPHHPRARSRLVLAAFIGTTAVTASAKLLWQRAYAEDSVNRDSRAE
SGEKVKHREEGESGGDEGRRAVASGSEQTQPEGKKKKSSGFRDRKVMEYENRIRAYSTPD
KIFRYFATLKVINEHGESEVFMTPQDFVRSITPNEKQPENLGLDQFIVKRYDGKKLSQER
EKFADEDSIFYALGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQ
VQSIIRSQTSMGMRHRDRSTTGNTLNTLKTGFNSALTTYFFGADLKGKLTISHFLDFQRK
LQHDILKLEFERHDPVDGRITERQFGSMLLAYSGVQSKKLTVMLKQLKKHFQDGEGLTFE
EVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDC
DGNGELSNKEFVAIMKQRLMRGLEKPKDMGFTRLMRAMWKCAQETAWDFTLPRP
Download sequence
Identical sequences G1N1M5
ENSMGAP00000005432 ENSMGAP00000005432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]