SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005519 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005519
Domain Number 1 Region: 3-59
Classification Level Classification E-value
Superfamily EF-hand 0.000000000259
Family Calmodulin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005519   Gene: ENSMGAG00000005592   Transcript: ENSMGAT00000006255
Sequence length 96
Comment pep:novel chromosome:UMD2:19:6215532:6225688:1 gene:ENSMGAG00000005592 transcript:ENSMGAT00000006255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYMEFDLNNQGEIDLMSVKRMMEKMGVPKTHLELKKMISEVTGGVSETISYQDFVNVMLG
KRSAVLKLVMMFEGKANESNPKPSGPPPERDIASLP
Download sequence
Identical sequences G1N1T7
ENSMGAP00000005519 ENSMGAP00000005519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]