SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005636 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005636
Domain Number 1 Region: 114-210
Classification Level Classification E-value
Superfamily EF-hand 7.7e-26
Family Eps15 homology domain (EH domain) 0.0000243
Further Details:      
 
Domain Number 2 Region: 261-361
Classification Level Classification E-value
Superfamily EF-hand 1.25e-25
Family Eps15 homology domain (EH domain) 0.0000547
Further Details:      
 
Domain Number 3 Region: 11-101
Classification Level Classification E-value
Superfamily EF-hand 2.1e-18
Family Eps15 homology domain (EH domain) 0.0000703
Further Details:      
 
Domain Number 4 Region: 382-565
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000347
Family Tropomyosin 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005636   Gene: ENSMGAG00000005657   Transcript: ENSMGAT00000006376
Sequence length 908
Comment pep:novel chromosome:UMD2:30:3691117:3719938:1 gene:ENSMGAG00000005657 transcript:ENSMGAT00000006376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIPLVFQFSAGIPLYETYYKQVDPTYTGRVGASEAALFLKKSGLSDIILGKIWDLADPEG
KGYLDKQGFYVALRLVACAQNGHEVNLSSLNLTVPPPKFHDTSSPLLITPPSTETHWAVR
VEEKAKFDGIFESLLPVNGLLSGDKVKPVLMNSKLPLDILGRVWDLSDIDKDGHLDKDEF
AVAMHLVYRALEKEPVPSLLPPSLIPPSKRKKTPVFPGAVPVLPASPPPKDSLRSTPSHG
SVNSLNSTGSLSPKHSIKQTQPSVNWVVPMSEKVRYDDIFLKTDTDMDGFVSGQEVKDIF
MHSGLSQNLLAHIWALADTRQIGKLSKDQFALAMYLIQQKVSKGIDPPQVLSPDMIPPTE
RTTPIQDSSSSVGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEDSIRQKTNEVQE
LQNDLDRETSNLQELEAQKQDAQDRLDEMDQQKAKLKDMLNDVRQKCQEETQVISSLKMQ
IQSQESDLKSQEDDLNRAKAELNRLQQEETQLEQSIQAGKVQLETIIKSLKSTQEEINQA
RSKLSQLQESHQEVSKSIEEYNEALNGVNGGSLTNLADISEGLGQTERSNYGAMDDPFKS
KALMFTNNTQELHTDPFQSEDPFKSDPFKGADPFKGSDPFQHDPFAEQPPAPADPFGGDP
FKESDPFRSSAPEDFFKKQVKSDPFTSDPFTKPSTLPSKPDPFESSDPFTSSSVSSKGPD
PFGTLDPFGSGAFSSGEGFADFSQMSKSVASDPFTSSFGGMGFSDDPFKSKSDTPALPPK
KNVPPRPKPPSGKSTPVSHLGSSDFPKPHDPFQPFGADSSDPFQSKKGFGDPFSGKDPFA
PSSSSKTSKDSSLGFADFSSFGNEEQQLAWAKRESEKAEQERLARLRRQEQEDLELAIAL
SKADMPSS
Download sequence
Identical sequences G1N225
ENSMGAP00000005636 ENSMGAP00000005636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]