SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005687 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005687
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 1.11e-30
Family Calmodulin-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005687   Gene: ENSMGAG00000005738   Transcript: ENSMGAT00000006429
Sequence length 187
Comment pep:novel chromosome:UMD2:30:3764883:3769104:1 gene:ENSMGAG00000005738 transcript:ENSMGAT00000006429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQTIFTPEQLDAYQDCTFFTRKEILRLFYRYRDLAPQLVPLDYTSRPDVALPYELIG
SMPELKDNPFRQRIAEVFSESGDGNMTLDDFLDMFSVLSEMAPRDLKAYYAFKIYDFNND
DYICKSDLEKTVNKLTRNELTPEEVSLACEKVIYEADLDNDGKLSLEDFQHMIIRAPDFL
STFHIRI
Download sequence
Identical sequences G1N263
XP_003213356.1.16129 XP_019465650.1.16129 ENSMGAP00000005687 ENSMGAP00000005687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]