SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005863 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005863
Domain Number 1 Region: 6-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000192
Family G proteins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005863   Gene: ENSMGAG00000005915   Transcript: ENSMGAT00000006607
Sequence length 220
Comment pep:novel chromosome:UMD2:4:19220286:19223182:1 gene:ENSMGAG00000005915 transcript:ENSMGAT00000006607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSNEMTINLAVLGRTQTGKSAAGNSLLGSLDFESHLSPSSVTTCCSLGCSCRILGITR
RNGCELVLRVRVLDTPSYPHSSLSKEQVKHTVRSALAHHFREEGLHLALLVLRADLPLCP
DENDQTILFIQELLGPTWKDFTAVLLTHADKAEAAGFSEETYLHKASSTLLSLLSSVQNK
YVFLDNQKSINKEERTTVLRKLLNFIRQNNYRVLLKHDKE
Download sequence
Identical sequences G1N2J4
ENSMGAP00000005863 ENSMGAP00000005863 XP_003205545.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]