SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006199 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006199
Domain Number 1 Region: 134-409
Classification Level Classification E-value
Superfamily Mitochondrial carrier 6.8e-81
Family Mitochondrial carrier 0.0000328
Further Details:      
 
Domain Number 2 Region: 3-111
Classification Level Classification E-value
Superfamily EF-hand 1.33e-27
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006199   Gene: ENSMGAG00000006210   Transcript: ENSMGAT00000006946
Sequence length 417
Comment pep:novel chromosome:UMD2:10:13129148:13138083:-1 gene:ENSMGAG00000006210 transcript:ENSMGAT00000006946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQQKIFKAGDTNQDGQLDFEEFMQYLKDHEKKMKLAFKSLDKNNDGKIEPSEVVQSLKIL
GINISEKQAEKILQSIDADGTMSVDWNEWRDHFMFNPATDIEEIIRYWKHSTAQDIGDSL
TVPDEFTEEEKKSGQWWKQLLAGGVAGAVSRTGTAPLDRLKVMMQVHGSKSNKMNIASGF
KQMLKEGGVRSLWRGNGVNVVKIAPETAIKFWAYEQYKKILTKDDGNLGTIERFVSGSLA
GATAQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKILKREGAKAFYKGYIPNILGIIPYA
GIDLAVYELLKTTWLEHYASSSANPGVFVLLGCGTVSSTCGQLASYPLALVRTRMQAQAS
VEGAPQLNMVGLFQRIVATEGIQGLYRGIAPNFMKVLPAVSISYVVYEKMKQNLGIA
Download sequence
Identical sequences G1N3C1
ENSMGAP00000006199 ENSMGAP00000006199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]