SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006483 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006483
Domain Number 1 Region: 313-485,518-682
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.92e-135
Family Mammalian PLC 0.0000000376
Further Details:      
 
Domain Number 2 Region: 915-968,1008-1160
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 6.41e-59
Family C-terminal domain of PLC-beta 0.0013
Further Details:      
 
Domain Number 3 Region: 141-312
Classification Level Classification E-value
Superfamily EF-hand 2.07e-55
Family EF-hand modules in multidomain proteins 0.00047
Further Details:      
 
Domain Number 4 Region: 12-140
Classification Level Classification E-value
Superfamily PH domain-like 1.66e-38
Family Pleckstrin-homology domain (PH domain) 0.00074
Further Details:      
 
Domain Number 5 Region: 704-819
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-27
Family PLC-like (P variant) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006483   Gene: ENSMGAG00000006407   Transcript: ENSMGAT00000007236
Sequence length 1175
Comment pep:novel chromosome:UMD2:2:13638080:13728658:-1 gene:ENSMGAG00000006407 transcript:ENSMGAT00000007236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKPYEFNWQKPVPSFMQDGAVFDRYEEESFVFESNCLFQVDEFGFFLSWKSEGKEGQVL
ECSLINSVRFGAVPKDPKILTALEAVGKSENELEGRIVCVCSGIDLVNISFTFMVAENTE
VAKQWVEGLGSIIHNFRANNVSPMTCLKKHWMKLAFLTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDTKRAMQIIETYEPDEDLKSKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQPLETHPLDPGKALPSPNDLKRKILIKNKRLKPEVEKKQLDALKKM
MEAGETAAPVNILEDDNEEEIESADQEEEAHPEYKFGSDLTVDDYSQKEAVAISVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMVNYAQPVKFQGFDIAEERNIHHNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPNDTSKNDRKGKANNAKANVTPQSSSELRPSTTAG
FGSGTDAKKGIDLIPQVKIEDLKQMKAYIKHLKKQQKELNALKKKHAKEHSAMQKLHCTQ
IDKIVAQYDKEKVSYEKMLEKAIKKKGGSNCVELKKETEIKIQALTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLNQQCELLKKLLINAHEQQTQQLKFSHDRESKEMRANQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEVLEKQNEQAKEMQQMVKLEAEMDRRPATVV
Download sequence
Identical sequences G1N3Z3
ENSMGAP00000006483 ENSMGAP00000006483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]