SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006579 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006579
Domain Number 1 Region: 3-151
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.65e-42
Family G proteins 0.000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006579   Gene: ENSMGAG00000006557   Transcript: ENSMGAT00000007333
Sequence length 169
Comment pep:novel chromosome:UMD2:5:10111043:10122923:-1 gene:ENSMGAG00000006557 transcript:ENSMGAT00000007333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSYFVTDYDPTIEDSYTKQCVIDERAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSV
TDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLDHQRQVTQEEGQQLARQLKVTYME
ASAKIRLNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Download sequence
Identical sequences G1N459
ENSMGAP00000006579 ENSMGAP00000006579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]