SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007078 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007078
Domain Number 1 Region: 67-190
Classification Level Classification E-value
Superfamily FKBP-like 1.77e-39
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 
Domain Number 2 Region: 194-310
Classification Level Classification E-value
Superfamily FKBP-like 1.75e-38
Family FKBP immunophilin/proline isomerase 0.00026
Further Details:      
 
Domain Number 3 Region: 304-406
Classification Level Classification E-value
Superfamily FKBP-like 5.11e-30
Family FKBP immunophilin/proline isomerase 0.00071
Further Details:      
 
Domain Number 4 Region: 1-73
Classification Level Classification E-value
Superfamily FKBP-like 1.22e-21
Family FKBP immunophilin/proline isomerase 0.00091
Further Details:      
 
Domain Number 5 Region: 420-486
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000158
Family Calmodulin-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007078   Gene: ENSMGAG00000006992   Transcript: ENSMGAT00000007843
Sequence length 500
Comment pep:novel chromosome:UMD2:29:4139989:4143119:1 gene:ENSMGAG00000006992 transcript:ENSMGAT00000007843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYDRGATVAGVVGVGRLITGMDRGLQGMCVNERRHLIVPPHLGYGSIGVAGLIPPDATLY
FDVVMLDIWNKDDKLQITTLAKPEHCNRTVENSDFVRYHYNGTLLDGTPFDSSYSKDSTY
DTYVGTGWLIKGMDQGLLGMCAGEKRSIIIPPFLAYGEKGYGTVIPPQASLVFSVLLVDF
HNPKDGISLEHLEVPASCRRRAVTGDFVRYHYNGTLMDGTLFDSSYSRNQTYNTYIGKGY
IIPGMDQGLQGVCIGERRRVVVPPHLAYGENGVGNKIPGSAVLIFDVHVIDFHNPADPVE
VETVHRPEGCNVTARDRDFIRYHYNCSLLDGTRLFSSHDYEKPQEVTLGANKVIEGLNSG
LLGMCVGERRVLIVPPHLGHGENGARGVPGSAVLRFEVELISLEEGVPEGYLFIWHGDPP
ENLFEQMDLNKDGQIPADEFSTFIKTQVAEGKGRLMPSSDPEKVIADMFGNQDRNQDGRI
TAEELKLKSDEDREKVHEEL
Download sequence
Identical sequences G1N580
ENSMGAP00000007078 ENSMGAP00000007078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]