SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007241 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007241
Domain Number 1 Region: 443-616
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.12e-49
Family Ypt/Rab-GAP domain of gyp1p 0.0034
Further Details:      
 
Domain Number 2 Region: 598-695
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.83e-20
Family Ypt/Rab-GAP domain of gyp1p 0.026
Further Details:      
 
Domain Number 3 Region: 762-902
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000102
Family Calmodulin-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007241   Gene: ENSMGAG00000007111   Transcript: ENSMGAT00000008010
Sequence length 1222
Comment pep:novel chromosome:UMD2:15:13194843:13209939:1 gene:ENSMGAG00000007111 transcript:ENSMGAT00000008010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLVGTLDVVLDSSARVAPYRILHQTQDSQVYWAVACGSSRKEITKHWEWLENNLLQTLS
IFDNEEDITTFVKGKIHGIIAEENKNQQPQSEEDPGKFKEAELKMRKQFGMPEVEKLVNY
YSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVTLVIQWVDVTQLEKNATLLFPECIKV
STRDSELYFSMFLNINETFKLMEQLANIAMRQLLDNESFLQDKSLPKPRKPLKNISALKR
DLDARAKNECYRATFRLPKDECLDGHTDCTLWTPFNKMHIPGQMFVSNNYICFASKAEEA
CHLIIPLREVTIVEKADSSSVLPSPLSISTKSKMTFFFANLKDRDFLVQRISDFLQRTPS
KKPLSSDREWKWNLGDPGCEEVPELPSSSPLAVSPTSALSNRPVNFCAGEVPTASQGLLK
LFRRNSEELLGPKGAKEKMKEESWNIHFFEYGRGMCMYRTTKTRELVQKGIPENLRGELW
LLFSGAWNEMVTHPGYYADLVEKSMGKYNLATEEIERDLHRSMPEHPAFQNELGIAALRR
VLTAYAFRNPTIGYCQAMNIVTSVLLLYCNEEEAFWLLVALCERMLPDYYNTRVVGALVD
QGIFEELTREYLPQLSEKMQELGVISTISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKF
ILQVSLAILDANVEKLLQCCDEGEAMTILGRYLDNVVNRQSVSPPIPHLHALLTSGDDPP
LEIDIFDLIKTSYEKFSNLKADDIEQMRFKQRLKVIQSLEDTAKKSVVRAVSGDIGFSIE
ELEELYVVFKAKYLMSCYWGNNRAAAARRDQSLPYLEQYRIDMEQFKELFITLTPWSCGA
HTPVLAGRLFRLLDENRDSLINFKEFVTGMSGMYHGDLTDKLKVLYKLHLPPGTALNPEE
TESALEATSYFTEDVTTEVSPFVSELDFCLHCESQVSLFLETQEEKGRRNDSGQEKEEKG
TSPQDYRYYLRMWAKEKESKKETIKDLPKMSQEQFIELCKTLYNMFSEDPVEQELYHAIA
TVASLLLRIGEVGKKFSNRPIRKSEDCKTNSSQDPVSEEESPTSEQSQNSTVEQQPRTDH
EDKTCREVQPEKTEQENQTLGDGSGEGQGSPLQLLSDDETKDDMSMSSYSMVSTGSLQCE
DIADDTVLVGCEGGSSAARYGSTIDTDWSISFEQILASMLTETALVNYFEKKVNILQKIK
DQKKVERQFSSSSDYELSSVSG
Download sequence
Identical sequences G1N5K3
ENSMGAP00000007241 ENSMGAP00000007241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]