SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007259 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007259
Domain Number 1 Region: 318-622
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.55e-112
Family Mammalian PLC 0.000000397
Further Details:      
 
Domain Number 2 Region: 158-315
Classification Level Classification E-value
Superfamily EF-hand 8.34e-38
Family EF-hand modules in multidomain proteins 0.017
Further Details:      
 
Domain Number 3 Region: 642-767
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.44e-32
Family PLC-like (P variant) 0.00038
Further Details:      
 
Domain Number 4 Region: 29-142
Classification Level Classification E-value
Superfamily PH domain-like 9.02e-26
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007259   Gene: ENSMGAG00000007167   Transcript: ENSMGAT00000008028
Sequence length 1015
Comment pep:novel chromosome:UMD2:7:10444972:10485063:-1 gene:ENSMGAG00000007167 transcript:ENSMGAT00000008028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDPSNQKCGRKKTVSFSSMPSEKKISSASDCISFMQAGCELKKVRPNSRIYNRFFTLDPD
LQALRWEPSKKDLEKAKLEISAIKEIRLGKNTETFRNNGLADQISEDCALSVIHGENYES
LDLVANSADVANIWVSGLRYLVSRSKQPLDLMESSHNTPRFAWLKTVFEAADVDGNGIML
EDTSVELIKKLNPTLKESKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLL
VQISKNKEYLDANDLMLFLEAEQGVTHITEEMCLDIIRRYELSQEGRLKGFLAIDGFTQY
LLSPECDIFDPEHKKIVQDMTQPLSHYYINASHNTYLIEDQLRGPADINGYVRALKMSCR
SIELDVCDGPDNEPIICNRNNMTSPLSFQNVIEVINKLAFFASEYPLILCLGNHCSVQQQ
KVVVQHMKRIFGNKLYTETPLSSEAYLPSPEKLKMKIIVKGKKLPCNQDVLEGEVTDEDE
EAEISRRLSEDFSREPKLIWLCRELSDLVSLCKSVQYKDFETSMKAQNYWEICSFSEAEA
SRIANEYPEDFVNYNKKFLSRVYPSAMRIDSSNLNPQDFWNCGCQIVAMNYQTPGPMMDL
HTGWFLQNGGCGYVLRPSVMREEVSYFSANTKGIVPGVSPQVLHVKIISGQNFPKPKGAC
AKGDVIDPYVCIEIHGIPADCTEQRTKTVQQNSDNPIFDESFEFQINLPELAMIRFVVLD
DDYIGDEFIGQYTIPLECLQPGYRHIPLRSFVGDIMEHVTLFVHIAITNRSGGGKAQKRS
LSVRIGKKAREYTMLRNTGLKTIDDIFKLAVHPLREATDMRENMQNAMVSVKELCGLPPI
ASLKQCILTLSSRLVSSENAPSVTLCMKDAFPYLEPLGTVPDVQKKVLAAYDLMIQESRV
LIETADITHDKIVQCQKAGMEFHEELHNLGTKEGLKGRKLSKAIESFAWNITVLKGQGDL
LKNAKNEALENMKQIQLACLSCGLSKTGSAHADAKSKRCLEAIQEKDTGDENGKQ
Download sequence
Identical sequences G1N5L5
ENSMGAP00000007259 ENSMGAP00000007259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]