SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007270 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007270
Domain Number 1 Region: 288-448
Classification Level Classification E-value
Superfamily EF-hand 7.1e-25
Family Calmodulin-like 0.0071
Further Details:      
 
Domain Number 2 Region: 45-271
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 5.89e-20
Family Glycerol-3-phosphate (1)-acyltransferase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007270   Gene: ENSMGAG00000007150   Transcript: ENSMGAT00000008039
Sequence length 488
Comment pep:novel chromosome:UMD2:3:35036418:35081550:-1 gene:ENSMGAG00000007150 transcript:ENSMGAT00000008039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIAFMTLTLFPIRLFFAAFMMLLAWPFAFIASMGCDEQELEKPLSWWRKIVDVLLKAIMR
MMWLAGGFHWINVKGRRALPAEAAILTVAPHSSYFDAIPVTMTFASIVMKAESKDIPVWG
TLIKYIRPVFVSRSDQDSRRKTVEEIKRRAQSGKWPQIMIFPEGTCTNRSCLITFKPGAF
IPGVPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNSVEIEFLPVYIPSEEERK
NPVLYANNVRRVMAEALGVPVTDYTFEDCQLALAEGQLRLPSDTCLLEFAKLVRSLGLKP
ETLEDDLNKYATRAMKMKKDKADLKEFSAYLEFPVSHTLESMFALFDENEDGIIDVREFV
IALSVVCKPSKTLETIQLAFQLYQSENGTITEEDLAHILKTAMGVSQINVTHLFRAVDEE
EKGKITYDDFYRFAELQPHFAEDYLYPDQMVAESGLETSSLSAPNGICTDFSPENAEDKN
KPLQKKWN
Download sequence
Identical sequences G1N5M4
ENSMGAP00000007270 ENSMGAP00000007270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]