SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007615 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007615
Domain Number 1 Region: 607-677
Classification Level Classification E-value
Superfamily EF-hand 0.000000173
Family Calmodulin-like 0.046
Further Details:      
 
Domain Number 2 Region: 361-418,456-580
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000942
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007615   Gene: ENSMGAG00000007479   Transcript: ENSMGAT00000008394
Sequence length 779
Comment pep:novel chromosome:UMD2:8:19647565:19662349:1 gene:ENSMGAG00000007479 transcript:ENSMGAT00000008394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESHFRSPEEHELEAVGKKAWDNPVYNGSPSTSLKIRAIYNPKSILENPYESFEEARDPVP
YQEEQNKTMEGKKSPFLKCCFYIFRGIRDPKGLWGTTLTENTAENRELYVKTTLRELLVY
IVFLVDICLLTYGMTSSNAYYYTKVMSELFLQTSSDNRVSFQSIGSMADFWVYAQGPLLD
NLYWTKWYNNESLAAHNAQSYIYYENLLLGVPRMRQLKVKNNSCVVHDDFKEEISGCYDV
YSEDKEEKVSFGLINGTAWRYHSEEELGGSSHWGRLTSYSGGGYYIDLKLTREESAEALQ
VLKEKLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVS
AWDFFIVACEIVFCVFIFYYVVEEILELCIHRLQYFTSIWNILDVVVILLSIVAIGFHIF
RTIEVNRLLGELLKHPETYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQL
SSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDY
NSIDNANRVLGPVYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELSSQKDELQLSDILKQ
SYNRTLMRLKLKKERISDVQKALQNGTKELGFEDFKKSLKELGHEEHEITAAFSRFDKDG
NRILDEEEQQQMKHDLEAKRVALNTEIENLGKSYGSNNLDANLSYMEAKNNHANKASWVS
KEEFQVLLQRVLHLEQSIHSIGSKIDAVVSKLEVLERNKLRVKDLMGKPLDNRLVTNPA
Download sequence
Identical sequences G1N6C6
ENSMGAP00000007615 ENSMGAP00000007615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]