SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007710 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007710
Domain Number 1 Region: 2-154
Classification Level Classification E-value
Superfamily EF-hand 2.4e-46
Family Penta-EF-hand proteins 0.000000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007710   Gene: ENSMGAG00000007570   Transcript: ENSMGAT00000008491
Sequence length 158
Comment pep:novel chromosome:UMD2:3:38246457:38251723:1 gene:ENSMGAG00000007570 transcript:ENSMGAT00000008491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVDKDRSGVISDTELQQALSNGTWTPFNPATVRSILGMFDRENKGGVNFNEFTGVWKYIT
DWQNVFRTYDRDNSGMIDKNELKQALTGFGYRLSDQFYDTLIRKFDRQGRGQVAFDDFIQ
CCVVLQRLTDVFRRYDTDQDGWIQVSYEQYLCMVFSIV
Download sequence
Identical sequences G1N6J5
ENSMGAP00000007710 ENSMGAP00000007710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]