SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007897 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007897
Domain Number 1 Region: 671-858,1171-1254,1451-1512
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.53e-104
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000096
Further Details:      
 
Domain Number 2 Region: 116-293
Classification Level Classification E-value
Superfamily EF-hand 1.11e-26
Family Calmodulin-like 0.0018
Further Details:      
 
Domain Number 3 Region: 308-362,456-524
Classification Level Classification E-value
Superfamily DUSP-like 1.02e-22
Family DUSP, domain in ubiquitin-specific proteases 0.0038
Further Details:      
 
Domain Number 4 Region: 12-103
Classification Level Classification E-value
Superfamily EF-hand 0.000000106
Family Calmodulin-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000007897
Domain Number - Region: 584-643
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000422
Family Ubiquitin-related 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007897   Gene: ENSMGAG00000007723   Transcript: ENSMGAT00000008685
Sequence length 1550
Comment pep:novel chromosome:UMD2:21:8370603:8408172:1 gene:ENSMGAG00000007723 transcript:ENSMGAT00000008685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIYCSFGGISKGLHFNNLIVGLVLLTRGKEEEKTKYIFSLFSNESGSYVVRDEMEKMLHV
VDGKVPESLKKCFSEGEKVNYEKFRIWLLHNKDAFTFSRWLLSGGVYVTLTDDSDTPTFY
QTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFAPLVSPPIHPSLSEGLFNAFDE
NRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDIDRDGVLSRTELKEMMVALLEVWKD
NRTDKIPELDMDLSEIVEDILNMHDNTKLGHLTLEDYQIWSVKSALANEFLNLLFQVCHI
VLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFLIAMPWWHQWKEYVKYDANPVVIEP
SSVLSGGKNSLIAAAANTSEQGEDKMGGLNYFSATEEKFSDNISTASEASETTSSNALYP
STPGTDVCIARQHNTSDNNNQCFLGTNGNTLLQLNPQKPGAIDNQPLVTQEPVKKAASLT
MEGGRLKRSPQLVEGRDYVMVPEPVWRALYHWYGANLSLPRPVIKNSKTNVPELELFPRY
LLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRI
KEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSSK
IDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTRYFISGRHLYELNRTNPIGMKG
HMAKCYGDLVQELWSGTQKNIAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDL
NRVHDKPYVELKDSDGRPDWEVAAEAWENHLRRNRSIVVDLFHGQLKSQVKCKTCGHISV
RFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLSELCGLKP
EQILLAEVHSSNIKNFPQDNQKVRLSVSGFLCAFEIPVPGSPTSASSPVQSDISTGSSAN
GAPNVMMNGDLPKPTLIPNGMPNTVVPCGTERNLANWTLNGHVPVLSDSPCTGYIIAVHR
KMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQEASNH
AQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIECTEDRASVGNAYIAVDWDP
TALHLRYQTSQERIVEEHESVEQSRRAQAEPINLDSCLRAFTSEEELGEDEMYYCSKCKT
HCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRENFDPSAFLVQRDPSHFQ
RKQLTPQIDEIPEARTLQGDSKKVDLQITYSTEGDVNRSPSSLNTANVMNNIKASPSLGR
KSGTSCPSSKSSSPNSSPRTLGRGKGRLRLPQLGKNKLSSSKENLDGSKENCTDQEQKIA
SDRSDTLTRGQNLGGSQNELYTELYTAQDNEVTLANGYICEQNAYSNGSINGQIDNHSEE
DIADDQREEVCVNPIYNLYAISCHSGIMGGGHYVTYAKNPNNKWYCYNDSSCKELHPDEI
DTDSAYILFYEQQGVDYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
Download sequence
Identical sequences G1N6X7
ENSMGAP00000007897 ENSMGAP00000007897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]