SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008028 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008028
Domain Number 1 Region: 268-339
Classification Level Classification E-value
Superfamily EF-hand 0.000000402
Family Calmodulin-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008028   Gene: ENSMGAG00000007875   Transcript: ENSMGAT00000008817
Sequence length 417
Comment pep:novel chromosome:UMD2:6:20461659:20503436:1 gene:ENSMGAG00000007875 transcript:ENSMGAT00000008817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFHLTGFVFSESESTALEQFEGGPCAVIAPVQAFLLKRLFTSEKSTWRDCPEVEQKNLLC
HTLCDILEMACSDNSESYSLATWIRGKTTEETASISEGPAESSRQEEQPXLAVEELGFER
FHALIHKRAFKSFPELKDAIWDQYSVWTNRFGVLLFLYSVILTKGTENIKNEIEDATEPL
IDPVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMKLLGIHKQATVGFLTLMESLRYCKV
GSYLKSPKFPIWILGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIPDTLL
EDVMKALDLVSDPEYVNLMKTKLDPEGLGIILLGPFLQEFFPEQDSRVSESFTVYHYNGL
KQSNYNEKVMYVEGTAVVMGFEEPMLQTDDTPVKRCLQTKWPYIELLWTTDQSPSLN
Download sequence
Identical sequences G1N773
ENSMGAP00000008028 ENSMGAP00000008028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]