SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008132 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008132
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily EF-hand 1.23e-34
Family Osteonectin 0.023
Further Details:      
 
Domain Number 2 Region: 89-185
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.7e-28
Family Thyroglobulin type-1 domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008132   Gene: ENSMGAG00000007969   Transcript: ENSMGAT00000008921
Sequence length 242
Comment pep:novel chromosome:UMD2:15:14360204:14374012:-1 gene:ENSMGAG00000007969 transcript:ENSMGAT00000008921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACTDKELRSLASRLKDWFGALHEDANRVIKPTSSETAQGRFDTSILPICKDSLGWMFNKL
DMNYDLLLDPSEISAIYLDKYEPCVKPLFNSCDSFKDGKLSNNEWCYCFQKPGGLPCQNE
MNRIQKLSRGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNEIAGSRKQGTVSC
EEEQETSGDFGSGGSVVLLDDLEEEPEATKKDKEGKLKIHVRAANEDDEDEDDDKDDEIG
YI
Download sequence
Identical sequences G1N7F0
ENSMGAP00000008132 ENSMGAP00000008132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]