SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008188 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008188
Domain Number 1 Region: 457-631
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.23e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 
Domain Number 2 Region: 609-708
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-17
Family Ypt/Rab-GAP domain of gyp1p 0.024
Further Details:      
 
Domain Number 3 Region: 775-966
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000244
Family Calmodulin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008188   Gene: ENSMGAG00000007992   Transcript: ENSMGAT00000008978
Sequence length 1121
Comment pep:novel chromosome:UMD2:9:17362586:17396121:1 gene:ENSMGAG00000007992 transcript:ENSMGAT00000008978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKPEEVLLNALKLWVLERSNQYFVLQRRRGYGEEGGGGLAGILEGTLDAVLDSTSKVAPF
RILHQTPDSQVYWSIACGASREEITEHWDWLEHNVMNILSVFDSNEDITSFVQGKIRGLI
AEEGKGSFTKEEDPEKFREGLMKFERCFGLPEQEKLVTYYSCSYWKGRVPCQGWLYLSTN
FLSFYSFLLGAEIKLIISWDAISKLEKTSNVILTESIHVCSHGEDHYFSMFLHINETFLL
MEQLANYAVRRLFDKETFENDLVLHDPLQITKRGLESRAHSQQFSAFFRLPKEETLKEVH
ECFLWVPFTHYNAHGKMCISENYICFASQDGSLCSVIIPLREVIGVDKADPANRGVNIST
KGKRAFRFTEVRDFEQLVTKLRIKCNATSSPQHINTEVAGSSASDSPKDFDEVPSKIDLR
DNTKTVSTEALMTVYHPQDAENLDPKMLKEKMKEQSWNILFFERGHGVSMFRTKKTRDLV
VRGIPEALRGELWLLFSGAVNDMASSPGYYTELVEKSLGTCTLATDEIERDLRRSLPEHP
AFQSDTGISALRRVLTAYAYRNPQIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCERMLP
DYFNRRIIGALVDQAVFEELIRVHLPQLTDHMMGMTFFSSVSLSWFLTLFISVLPIESAV
NVVDCFFYDGIKAILQLGLAVLEYNMDKLLTCKDDAEAVTVLNRFFDSVTNKDSPLPPAV
QQGSNLSDAKGDHPKVDITDLIRESNERYGDIRYEDVESMRCRNRLYVIQTLEATTKQNV
LRVVSQDVKFSPNDLDELYELFKREHFLSCYWNVYSPVLEHHDASLPYLEQYRIDCQQFR
VLCHLLSPWAHCANRDSIALWTFRLMDENCHGLINFKQFSCVLDTMYNGSFTDKLKLLFK
LHIPPAFTEVESLSPSKGVDLSKEELIHFSQLSVSSAGDSLESDALKSSPEKGKGKVDIQ
AYLKQWQDELLKKEENIKDLPRMNQSQFIQFSKTLYNLFHGDPEEELLYRAIAVVTSLLL
KMEEVGRRLQSPTSPVRSLAATTAVSAESPQKGQEEGSSEQTEGSGAQSLRKSHEWSFAF
EQILASLLNEPAFVRFFEKPHEIKTRIESAKNLQLKARTRV
Download sequence
Identical sequences G1N7I9
ENSMGAP00000008188 ENSMGAP00000008188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]